You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
HOXC5 monoclonal antibody (M01), clone 1E10
Catalog Number: orb2292783
| Catalog Number | orb2292783 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant HOXC5. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR |
| Tested applications | ELISA, WB |
| Clone Number | 1E10 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_061826.1 |
Detection limit for recombinant GST tagged HOXC5 is approximately 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa).
