You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292788 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human HOXB7 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | HOXB7 (AAH15345.1, 1 a.a. ~ 217 a.a) full-length human protein. |
Protein Sequence | MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH15345.1 |
Immunofluorescence of purified MaxPab rabbit antibody to HOXB7 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 MaxPab polyclonal antibody. Lane 1: HOXB7 transfected lysate (24.00 KDa). Lane 2: Non-transfected lysate.