HOXB7 monoclonal antibody (M03), clone 4C6

• Catalog Number: orb2292786
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HOXB7.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 4C6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004493

Detection limit for recombinant GST tagged HOXB7 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml]

Western Blot detection against Immunogen (33 KDa).