HOXB7 Rabbit Polyclonal Antibody

SKU: orb576198

Description

Rabbit polyclonal antibody to HOXB7

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB7
• Target: HOXB7
• Protein Sequence: Synthetic peptide located within the following region: AGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH
• Molecular Weight: 24kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Hox-2., Hox-2.3, AI325018

WB Suggested Anti-HOXB7 Antibody Titration: 1.0 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.

Quick Database Links

Gene Symbol

HOXB7

UniProt

P09024

RefSeq (Protein):NP_034590