HOXB3 Rabbit Polyclonal Antibody

SKU: orb573736

Description

Rabbit polyclonal antibody to HOXB3

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB3
• Target: HOXB3
• Protein Sequence: Synthetic peptide located within the following region: GPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGG
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HOX2, HOX2G, Hox-2.7

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. HOXB3 is supported by BioGPS gene expression data to be expressed in HepG2.

Positive control (+): Hela (HL), Negative control (-): Human heart muscle, Antibody concentration: 1 ug/ml.

WB Suggested Anti-HOXB3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, HOXB3 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-HOXB3 antibody Titration: 1 ug/ml, Sample Type: Human heart.

Quick Database Links

Gene Symbol

HOXB3

UniProt

P14651

RefSeq (Protein):NP_002137