HOXA10 Rabbit Polyclonal Antibody

• Catalog Number: orb592942
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXA10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: HOXA10
• UniProt ID: P31260
• Protein Sequence: Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL
• NCBI: NP_061824
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PL, HOX1, HOX1H, HOX1.8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-HOXA10 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate. There is BioGPS gene expression data showing that HOXA10 is expressed in Jurkat.