RP11-78J21.1 Rabbit Polyclonal Antibody

SKU: orb324844

Description

Rabbit polyclonal antibody to HNRNPA1L2

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-78J21.1
• Target: HNRNPA1L2
• Protein Sequence: Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Rabbit Anti-RP11-78J21.1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Epidermal cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-RP11-78J21.1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, HNRNPA1L2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

HNRNPA1L2

UniProt

Q6IPF2

RefSeq (Protein):NP_001011724