Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HNF4A Rabbit Polyclonal Antibody

SKU: orb330420

Description

HNF4A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HNF4A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human HNF4A. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HNF4A
TargetHNF4A
Protein SequenceSynthetic peptide located within the following region: LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI
Molecular Weight49kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ39654 antibody, anti HNF4 antibody, anti HNF4a7 antibody, anti HNF4a8 antibody, anti HNF4a9 antibody, anti MODY antibody, anti MODY1 antibody, anti NR2A1 antibody, anti NR2A21 antibody, anti TCF antibody, anti TCF14 antibody, anti HNF4alpha antibody

Similar Products

  • HNF1A Rabbit Polyclonal Antibody [orb1816953]

    IF,  IHC-Fr,  IHC-P

    Bovine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • HNF4A Rabbit Polyclonal Antibody [orb329630]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNF4A Rabbit Polyclonal Antibody [orb5453]

    ChIP,  IF,  IHC-Fr,  IHC-P,  IP,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HNF1A Rabbit Polyclonal Antibody [orb10829]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Gallus, Porcine, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HNF4A Antibody (Center) [orb1931464]

    FC,  IF,  IHC-P,  WB

    Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry