HNF1B Rabbit Polyclonal Antibody

SKU: orb574470

Description

Rabbit polyclonal antibody to HNF1B

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B
• Target: HNF1B
• Protein Sequence: Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD
• Molecular Weight: 61kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-HNF1B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, HNF1B is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

HNF1B

UniProt

P35680

RefSeq (Protein):NP_000449