HMGCR antibody

Catalog Number: orb592579

Catalog Number	orb592579
Category	Antibodies
Description	Rabbit polyclonal antibody to HMGCR
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Human
Reactivity	Human
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human HMGCR
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	97 kDa
Target	HMGCR
UniProt ID	P04035
Protein Sequence	Synthetic peptide located within the following region: GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL
NCBI	NP_000850.1
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	LDLCQ3 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Applications:	IHC-P
Reactivity:	Bovine, Canine, Gallus, Human, Mouse, Porcine, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	FC, IHC-P, WB
Predicted Reactivity:	Bovine, Canine, Gallus, Porcine, Rabbit

Applications:	FC, IHC-P
Predicted Reactivity:	Bovine, Canine, Equine, Gallus, Porcine

Applications:	ELISA, ICC, IHC-Fr, IHC-P, WB
Reactivity:	Human, Monkey, Mouse, Porcine, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated