SMARCA3 Rabbit Polyclonal Antibody

• Catalog Number: orb324756
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HLTF
• Target: HLTF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCA3
• Protein Sequence: Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
• UniProt ID: Q14527
• MW: 114kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ZBU1 antibody, anti HLTF1 antibody, anti RNF8
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_620636
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SMARCA3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Transfected 293T.