You have no items in your shopping cart.
Cart summary
Item 1 of 1
HLCS Rabbit Polyclonal Antibody
Catalog Number: orb588405
| Catalog Number | orb588405 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HLCS |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen for Anti-HLCS antibody is: synthetic peptide directed towards the C-terminal region of Human BPL1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 79 kDa |
| Target | HLCS |
| UniProt ID | P50747 |
| Protein Sequence | Synthetic peptide located within the following region: MSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETF |
| NCBI | XP_006724059.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HCS Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-BPL1 antibody Titration: 1 ug/ml, Sample Type: Human 786-0 Whole Cell.
- Item 1 of 2
HLCS Rabbit Polyclonal Antibody [orb77697]
ELISA, IHC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
