You have no items in your shopping cart.
HLA-DOA Rabbit Polyclonal Antibody
SKU: orb326531
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DOA |
| Target | HLA-DOA |
| Protein Sequence | Synthetic peptide located within the following region: LMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLK |
| Molecular Weight | 27kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti HLA-DOA antibody, anti HLA-DNA antibody, anti HLA-DZA antibody, anti antibody
Similar Products
−- Item 1 of 2
HLA-DOA Rabbit Polyclonal Antibody [orb319018]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 2
HLA-DOα (V111) polyclonal antibody [orb643915]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
25 μl, 200 μl, 100 μl, 50 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Type: MDA-MB-435s Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
Documents Download
Datasheet
Product Information
Request a Document
HLA-DOA Rabbit Polyclonal Antibody (orb326531)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks