HIST2H2BF Rabbit Polyclonal Antibody

• Catalog Number: orb583065
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HIST2H2BF
• Target: HIST2H2BF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF
• Protein Sequence: Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
• UniProt ID: Q5QNW6
• MW: 14kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HIST2H2BF
• Note: For research use only
• NCBI: NP_001019770

Chromatin Immunoprecipitation (ChIP) Using HIST2H2BF antibody - N-terminal region (orb583065) and HCT116 Cells.

WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Small Intestine.