You have no items in your shopping cart.
Cart summary
HIPK2 Peptide - middle region
Catalog Number: orb2006939
| Catalog Number | orb2006939 |
|---|---|
| Category | Proteins |
| Description | HIPK2 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR |
| UniProt ID | Q9H2X6 |
| MW | 120kDa |
| Tested applications | IHC, WB |
| Application notes | This is a synthetic peptide designed for use in combination with HIPK2 Rabbit Polyclonal Antibody (orb574278). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | DKFZp686K02111, FLJ23711, PRO0593 |
| Note | For research use only |
| NCBI | NP_073577 |
