HEY1 monoclonal antibody (M02), clone 2F10

• Catalog Number: orb2291330
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HEY1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
• Tested applications: ELISA, WB
• Clone Number: 2F10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_036390

Detection limit for recombinant GST tagged HEY1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M02), clone 2F10. Lane 1: HEY1 transfected lysate(32.613 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).