HEY1 Rabbit Polyclonal Antibody

• Catalog Number: orb587882
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HEY1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEY1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: HEY1
• UniProt ID: Q9Y5J3
• Protein Sequence: Synthetic peptide located within the following region: SSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEK
• NCBI: NP_036390
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CHF2, OAF1, HERP2, HESR1, HRT-1, NERP2, hHRT1, BHL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Fetal Kidney lysates, Antibody Dilution: 0.6 ug/ml.