HES7 Rabbit Polyclonal Antibody

SKU: orb573558

Description

Rabbit polyclonal antibody to HES7

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HES7
• Target: HES7
• Protein Sequence: Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP
• Molecular Weight: 25kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SCDO4, bHLHb37

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-HES7 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HES7 Antibody, Paraffin Embedded Tissue: Human Pancreas, Cellular Data: Epithelial cells of pancreatic acinus, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HES7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

HES7

UniProt

Q9BYE0

RefSeq (Protein):NP_115969