You have no items in your shopping cart.
Cart summary
Item 1 of 1
Hes6 Rabbit Polyclonal Antibody
Catalog Number: orb574433
| Catalog Number | orb574433 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Hes6 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Reactivity | Mouse |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Hes6 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 24kDa |
| Target | Hes6 |
| UniProt ID | Q9JHE6 |
| Protein Sequence | Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY |
| NCBI | NP_062352 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | bHLHb4, bHLHb41, AI326893 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Hes6 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Stomach.
- Item 1 of 4
- Item 1 of 1
HES6 Rabbit Polyclonal Antibody [orb157511]
WB
Bovine, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
HES6 Rabbit Polyclonal Antibody [orb574432]
IHC, WB
Canine, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
- Item 1 of 1
