HERC3 Rabbit Polyclonal Antibody

• Catalog Number: orb578743
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HERC3
• Target: HERC3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HERC3
• Protein Sequence: Synthetic peptide located within the following region: PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
• UniProt ID: Q15034
• MW: 115 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Cancer Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_055421

Sample Tissue: Human Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/ml.