HECTD1 monoclonal antibody (M03), clone 1E10

• Catalog Number: orb2291290
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HECTD1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
• Tested applications: ELISA, WB
• Clone Number: 1E10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_056197

Detection limit for recombinant GST tagged HECTD1 is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (37.62 KDa).