Hebp2 Rabbit Polyclonal Antibody

• Catalog Number: orb582590
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hebp2
• Target: Hebp2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of RAT Hebp2
• Protein Sequence: Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN
• UniProt ID: D3ZHC4
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001100985

Sample Tissue: Rat Lung, Antibody dilution: 1 ug/ml.

Sample Tissue: Rat Rat Heart, Antibody dilution: 1 ug/ml.