Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HDAC4 Rabbit Polyclonal Antibody

SKU: orb329766

Description

HDAC4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HDAC4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC4. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HDAC4
TargetHDAC4
Protein SequenceSynthetic peptide located within the following region: EKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNH
Molecular Weight119kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HA6116 antibody, anti HD4 antibody, anti HDAC-A antibody, anti HDACA antibody, anti KIAA0288 antibody, anti AHO3 antibody, anti BDMR antibody, anti HDAC-4 antibody

Similar Products

  • HDAC4 Rabbit Polyclonal Antibody [orb18862]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-HDAC4 (Ser246) + HDAC5 (Ser259) + HDAC7 (Ser155) Rabbit Polyclonal Antibody [orb6132]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-HDAC4 (Ser246) Rabbit Polyclonal Antibody [orb157455]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-HDAC5 (Ser259) Rabbit Polyclonal Antibody [orb157458]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HDAC4 rabbit pAb Antibody [orb765376]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HDAC4 Rabbit Polyclonal Antibody

Rabbit Anti-HDAC4 Antibody, Catalog Number: orb329766, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

HDAC4 Rabbit Polyclonal Antibody

WB Suggested Anti-HDAC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006028

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HDAC4 Rabbit Polyclonal Antibody (orb329766)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry