HBZ Rabbit Polyclonal Antibody

• Catalog Number: orb578390
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HBZ
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HBZ
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: HBZ
• UniProt ID: P02008
• Protein Sequence: Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
• NCBI: NP_005323
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HBAZ, HBZ1, HBZ-T1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-HBZ Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hemopoietic, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HBZ Antibody Titration: 1.25 ug/ml, Positive Control: K562 cell lysate. HBZ is supported by BioGPS gene expression data to be expressed in K562.