HBsAg preS1 Protein

SKU: orb426010

Description

Recombinant of HBsAg preS1 protein

Images & Validation

• Application Notes:
  Viral Antigens- Hepatitis B Surface Antigens

Key Properties

• Source: Escherichia Coli
• Protein Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
• Purification: HBsAg protein was purified by proprietary chromatographic technique.
• Purity: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Storage & Handling

• Storage: Stability: This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles
• Buffer/Preservatives: HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.
• Disclaimer: For research use only