HAVCR2 Rabbit Polyclonal Antibody

SKU: orb579496

Description

Rabbit polyclonal antibody to HAVCR2

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HAVCR2
• Target: HAVCR2
• Protein Sequence: Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2

WB Suggested Anti-HAVCR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate.

Quick Database Links

Gene Symbol

HAVCR2

UniProt

Q8TDQ0

RefSeq (Protein):NP_116171