HAL Rabbit Polyclonal Antibody

• Catalog Number: orb325225
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HAL
• Target: HAL
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAL
• Protein Sequence: Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK
• UniProt ID: P42357
• MW: 72kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HIS antibody, anti HSTD antibody
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_002099

Human Muscle

WB Suggested Anti-HAL Antibody Titration: 1.25 ug/mL, Positive Control: Fetal liver cell lysate.