You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978434 |
---|---|
Category | Proteins |
Description | H2BC12 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. |
Tag | N-10xHis, C-Myc |
Purity | 98.00% |
Protein Sequence | PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK |
UniProt ID | O60814 |
MW | 21.2 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | H2BC12 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. |
Expression Region | 2-126 aa |
Storage | -20°C |
Note | For research use only |