Gyg Rabbit Polyclonal Antibody

SKU: orb325406

Description

Rabbit polyclonal antibody to Gyg

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Gyg
• Protein Sequence: Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
• Molecular Weight: 39 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AU017667 antibody, anti Gyg1 antibody

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by glycosylation.

Rabbit Anti-Gyg antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-Gyg antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Skeletal Myocytes, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Gyg Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Kidney.

Quick Database Links

Gene Symbol

Gyg

UniProt

Q9R062

RefSeq (Protein):NP_038783