GUCY1B1 Rabbit Polyclonal Antibody

SKU: orb579619

Description

Rabbit polyclonal antibody to GUCY1B1

Images & Validation

−

Item 1 of 1

Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
Target	GUCY1B1
Molecular Weight	71 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Disclaimer	For research use only

Alternative Names

−

GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human HepG2 Whole cell, Antibody dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

GUCY1B1

UniProt

Q02153

RefSeq (Protein):NP_000848

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000848

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols