You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334478 |
---|---|
Category | Antibodies |
Description | GTPase HRAS Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, By Heat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 21298 MW |
UniProt ID | P01112 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | GTPase HRas;H-Ras-1;Ha-Ras;Transforming protein p2 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis using Anti-GTPase HRAS antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:HEPA Cell.
IHC analysis of GTPase HRAS using anti-GTPase HRAS antibody.GTPase HRAS was detected in paraffin-embedded section of mouse intestine tissues.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating