GTF2I monoclonal antibody (M01), clone 3E2

• Catalog Number: orb2292855
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant GTF2I.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E2
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GTF2I (AAH04472.1, 36 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
• NCBI: AAH04472.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GTF2I is approximately 0.03 ng/ml as a capture antibody.

GTF2I monoclonal antibody (M01), clone 3E2. Western Blot analysis of GTF2I expression in human colon.

Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (52.03 KDa).