You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292855 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant GTF2I. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | GTF2I (AAH04472.1, 36 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 3E2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH04472.1 |
Detection limit for recombinant GST tagged GTF2I is approximately 0.03 ng/ml as a capture antibody.
GTF2I monoclonal antibody (M01), clone 3E2. Western Blot analysis of GTF2I expression in human colon.
Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (52.03 KDa).