GTF2H4 Rabbit Polyclonal Antibody

• Catalog Number: orb576506
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2H4
• Target: GTF2H4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H4
• Protein Sequence: Synthetic peptide located within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
• UniProt ID: Q92759
• MW: 52kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P52, TFB2, TFIIH
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_001508

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-GTF2H4 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.