GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292860
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human GSTP1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human, Mouse
• Immunogen: GSTP1 (AAH10915.1, 1 a.a. ~ 210 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• NCBI: AAH10915.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in HeLa.

GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.

GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in mouse liver.

Proximity Ligation Analysis of protein-protein interactions between GSTP1 and MAPK8. HeLa cells were stained with anti-GSTP1 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 MaxPab polyclonal antibody. Lane 1: GSTP1 transfected lysate (23.30 KDa). Lane 2: Non-transfected lysate.