GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292863
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human GSTA4 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: GSTA4 (NP_001503.1, 1 a.a. ~ 222 a.a) full-length human protein.
• Protein Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001503.1

GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in human placenta.

GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in Jurkat.

GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in mouse spleen.

Western Blot analysis of GSTA4 expression in transfected 293T cell line by GSTA4 MaxPab polyclonal antibody. Lane 1: GSTA4 transfected lysate (25.70 KDa). Lane 2: Non-transfected lysate.