You have no items in your shopping cart.
Cart summary
GSTA1 Protein, Rat, Recombinant (His & SUMO)
Catalog Number: orb1976615
| Catalog Number | orb1976615 |
|---|---|
| Category | Proteins |
| Description | GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| Protein Sequence | SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF |
| UniProt ID | P00502 |
| MW | 41.5 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Rat |
| Biological Activity | GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli. |
| Expression Region | 2-222 aa |
| Storage | -20°C |
| Note | For research use only |
