Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GSPT1 Rabbit Polyclonal Antibody

SKU: orb331299

Description

GSPT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GSPT1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSPT1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human GSPT1
TargetGSPT1
Protein SequenceSynthetic peptide located within the following region: AGGRAAPVESSQEEQSLCEGSNSAVSMELSEPIENGETEMSPEESWEHKE
Molecular Weight70kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 551G9.2 antibody, anti ETF3A antibody, anti FLJ38048 antibody, anti FLJ39067 antibody, anti GST1 antibody, anti eRF3a antibody

Similar Products

  • GSPT1,2/GSPT1 Rabbit Polyclonal Antibody [orb865529]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GSPT1 Antibody (N-term) [orb694025]

    FC,  IHC-P,  WB

    Mouse

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GSPT1 Rabbit Polyclonal Antibody [orb627535]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GSPT1 Rabbit Polyclonal Antibody [orb318984]

    IHC,  WB

    Human, Mouse, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • GSPT1 Rabbit Polyclonal Antibody [orb2953947]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GSPT1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

GSPT1 Rabbit Polyclonal Antibody

WB Suggested Anti-GSPT1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell, GSPT1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GSPT1 Rabbit Polyclonal Antibody (orb331299)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry