GSN Rabbit Polyclonal Antibody

SKU: orb582275

Description

Rabbit polyclonal antibody to GSN

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSN
• Target: GSN
• Protein Sequence: Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
• Molecular Weight: 83kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ADF, AGEL

GSN antibody - C-terminal region (orb582275) validated by WB using pFA fixed human tonsil tissue.

GSN antibody - C-terminal region (orb582275), Catalog Number: orb582275, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of pneumocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IHC Information: Paraffin embedded tonsil tissue, tested with an antibody Dilution of 5 ug/ml.

WB Suggested Anti-GSN Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

GSN

UniProt

P06396

RefSeq (Protein):NP_000168