GSDME Rabbit Polyclonal Antibody

• Catalog Number: orb579672
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GSDME
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DFNA5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: GSDME
• UniProt ID: A4FVA8
• Protein Sequence: Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
• NCBI: AAI25067
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DFNA5, ICERE-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-DFNA5 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. DFNA5 is supported by BioGPS gene expression data to be expressed in HepG2.