GroEL Antibody

SKU: orb180470

Description

Goat polyclonal antibody to GroEL. GroEL protein is a 60 kDa chaperone that promotes refolding of misfolded polypeptides especially under stressful conditions.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:5,000
• Reactivity: Bacteria, Pseudomonas sp
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 400 aa to the C-terminus of Burkholderia GroEL produced in E. coli. Antigen Sequence: DALHATRAAVEEGIVAGGGVALIRARTAIAGLTGANADQNAGIKIVLRAMEEPLRQIVTNGGEEASVVVAAVAAGKGNYGYNAATGEYVD
• Target: Chaperonin GroEL protein
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

chaperonin GroEL protein antibody.

Quick Database Links

Gene Symbol

Chaperonin GroEL protein