GRAMD2B Rabbit Polyclonal Antibody

SKU: orb330598

Description

GRAMD2B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GRAMD2B. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human GRAMD3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRAMD3
• Target: GRAMD2B
• Protein Sequence: Synthetic peptide located within the following region: LSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDE
• Molecular Weight: 48kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ21313 antibody, anti NS3TP2 antibody

Quick Database Links

Gene Symbol

GRAMD2B

UniProt

Q96HH9

RefSeq (Protein):NP_076416