GPT Rabbit Polyclonal Antibody

SKU: orb330441

Description

Rabbit polyclonal antibody to GPT

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPT
• Target: GPT
• Protein Sequence: Synthetic peptide located within the following region: CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI
• Molecular Weight: 55kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AAT1 antibody, anti ALT1 antibody, anti GPT1 antibody

Immunohistochemistry with Fetal liver cell lysate tissue at an antibody concentration of 5.0 ug/mL using anti-GPT antibody (orb330441).

WB Suggested Anti-GPT Antibody Titration: 1.25 ug/mL, Positive Control: 293T cells lysate, GPT is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

GPT

UniProt

P24298

RefSeq (Protein):NP_005300