GPR75 Rabbit Polyclonal Antibody

• Catalog Number: orb574513
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPR75
• Target: GPR75
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPR75
• Protein Sequence: Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS
• UniProt ID: O95800
• MW: 59 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GPRchr2, WI31133
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_006785

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment. Multiple bands may reflect known n-linked glycosylation.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1 ug/ml. Multiple glycosylated forms may appear above target size molecular weight.

WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: COLO205 cell lysate, GPR75 is supported by BioGPS gene expression data to be expressed in COLO205.