GPR68 Rabbit Polyclonal Antibody

• Catalog Number: orb585966
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPR68
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GPR68
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: GPR68
• UniProt ID: Q15743
• Protein Sequence: Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL
• NCBI: NP_003476
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OGR1, AI2A6, GPR12A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Rat liver (R-LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GPR68 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.