GPR27 Rabbit Polyclonal Antibody

SKU: orb580233

Description

Rabbit polyclonal antibody to GPR27

Research Area

Cell Biology, Pharmacology & Drug Discovery, Protein Biochemistry, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPR27
• Target: GPR27
• Protein Sequence: Synthetic peptide located within the following region: LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SREB1

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 2 ug/ml.

WB Suggested Anti-GPR27 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

GPR27

UniProt

Q9NS67

RefSeq (Protein):NP_061844