GPR21 Rabbit Polyclonal Antibody

SKU: orb586679

Description

Rabbit polyclonal antibody to GPR21

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR21
• Target: GPR21
• Protein Sequence: Synthetic peptide located within the following region: FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Sample Type: Fetal Heart lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-GPR21 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skeletal Muscle, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

GPR21

UniProt

Q99679

RefSeq (Protein):NP_005285