GPR19 Rabbit Polyclonal Antibody

• Catalog Number: orb585483
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPR19
• Target: GPR19
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY
• UniProt ID: Q15760
• MW: 46kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Immunology & Inflammation, Pharmacology & Drug Dis
• Note: For research use only
• NCBI: NP_006134

Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GPR19 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal kidney.