You have no items in your shopping cart.
Cart summary
Item 1 of 1
GPR173 Rabbit Polyclonal Antibody
Catalog Number: orb587021
| Catalog Number | orb587021 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GPR173 |
| Target | GPR173 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR173 |
| Protein Sequence | Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV |
| UniProt ID | Q9NS66 |
| MW | 41kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SREB3 |
| Note | For research use only |
| NCBI | NP_061842 |
Sample Type: 721_B Whole cell lysates, Antibody dilution: 1.0 ug/ml. GPR173 is supported by BioGPS gene expression data to be expressed in 721_B.
- Item 1 of 3
Anti-GPR173 Antibody [orb215197]
IF, IH, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 4
- Item 1 of 2
Anti-GPR173 Antibody [orb515450]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
- Item 1 of 1
