You have no items in your shopping cart.
Cart summary
Item 1 of 1
GPR142 Rabbit Polyclonal Antibody
Catalog Number: orb331350
| Catalog Number | orb331350 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GPR142 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR142 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 50kDa |
| Target | GPR142 |
| UniProt ID | Q7Z601 |
| Protein Sequence | Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH |
| NCBI | NP_861455 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti PGR2 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: MDA-MB-435s Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
GPR142 Rabbit Polyclonal Antibody [orb157321]
WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl - Item 1 of 1
