GNAO1 Rabbit Polyclonal Antibody

• Catalog Number: orb582754
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAO1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAO1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: GNAO1
• UniProt ID: B3KP89
• Protein Sequence: Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
• NCBI: NP_620073
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GNAO, DEE17, NEDIM, EIEE17, HLA-DQB1, G-ALPHA-o
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-GNAO1 antibody (orb582754).

WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that GNAO1 is expressed in 721_B.